Chemokine (C-X-C motif) ligand 1

UniProt : A2RTH0, P12850, UniProt ID: A2RTH0_MOUSE, GROA_MOUSE,

Chemokine (C-X-C motif) ligand 1

Mus musculus

MIPATRSLLCAALLLLATSRLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCT
QTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Chemokine (C-X-C motif) ligand 1 contains a PF00048 domain.

Chemokine (C-X-C motif) ligand 1 is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. LATG-APIA.