Parathyroid hormone

UniProt : P01270, UniProt ID: PTHY_HUMAN,

Parathyroid hormone

Homo sapiens

MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQ
DVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Parathyroid hormone contains a PF01279 domain.

Parathyroid hormone is proteolytically cut by furin (S08.071) cleavage. VKKR-SVSE.

Parathyroid hormone is proteolytically cut by furin (S08.071) cleavage. VKKR-SVSE.

Parathyroid hormone is proteolytically cut by omptin (A26.001) cleavage. GFLR-RIRK.

Parathyroid hormone is proteolytically cut by omptin (A26.001) cleavage. WLRK-KLQD.