cDNA, FLJ95028, Homo sapiens matrix metalloproteinase 16 (membrane-inserted)(MMP16), transcript variant 1, mRNA (Matrix metallopeptidase 16 (Membrane-inserted), isoform CRA_a)

UniProt : B2RAN7, P51512, UniProt ID: B2RAN7_HUMAN, MMP16_HUMAN,

cDNA, FLJ95028, Homo sapiens matrix metalloproteinase 16 (membrane-inserted)(MMP16), transcript variant 1, mRNA (Matrix metallopeptidase 16 (Membrane-inserted), isoform CRA_a)

Homo sapiens

MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM
SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRY
ALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR
DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT
RPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVF
KDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ
PGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVW
KGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVK
EGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCK
RSMQEWV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ95028, Homo sapiens matrix metalloproteinase 16 (membrane-inserted)(MMP16), transcript variant 1, mRNA (Matrix metallopeptidase 16 (Membrane-inserted), isoform CRA_a) contains a PF01471 domain.

cDNA, FLJ95028, Homo sapiens matrix metalloproteinase 16 (membrane-inserted)(MMP16), transcript variant 1, mRNA (Matrix metallopeptidase 16 (Membrane-inserted), isoform CRA_a) contains a PF00413 domain.

cDNA, FLJ95028, Homo sapiens matrix metalloproteinase 16 (membrane-inserted)(MMP16), transcript variant 1, mRNA (Matrix metallopeptidase 16 (Membrane-inserted), isoform CRA_a) contains a PF00045 domain.

cDNA, FLJ95028, Homo sapiens matrix metalloproteinase 16 (membrane-inserted)(MMP16), transcript variant 1, mRNA (Matrix metallopeptidase 16 (Membrane-inserted), isoform CRA_a) contains a PF00045 domain.

cDNA, FLJ95028, Homo sapiens matrix metalloproteinase 16 (membrane-inserted)(MMP16), transcript variant 1, mRNA (Matrix metallopeptidase 16 (Membrane-inserted), isoform CRA_a) contains a PF00045 domain.

cDNA, FLJ95028, Homo sapiens matrix metalloproteinase 16 (membrane-inserted)(MMP16), transcript variant 1, mRNA (Matrix metallopeptidase 16 (Membrane-inserted), isoform CRA_a) contains a PF00045 domain.

cDNA, FLJ95028, Homo sapiens matrix metalloproteinase 16 (membrane-inserted)(MMP16), transcript variant 1, mRNA (Matrix metallopeptidase 16 (Membrane-inserted), isoform CRA_a) is proteolytically cut by furin (S08.071) cleavage. FHIR-RKRY.