Putative uncharacterized protein KLKB1 (Kallikrein B, plasma (Fletcher factor) 1, isoform CRA_b)

UniProt : Q4W5C3, UniProt ID: Q4W5C3_HUMAN,

Putative uncharacterized protein KLKB1 (Kallikrein B, plasma (Fletcher factor) 1, isoform CRA_b)

Homo sapiens

MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLF
SFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVD
MRGVNFNVSKVSSVEECQKRCTSNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIK
VLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFF
TFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGV
DFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRI
AYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCG
GSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEG
NHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNI
PLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGE
GCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein KLKB1 (Kallikrein B, plasma (Fletcher factor) 1, isoform CRA_b) contains a PF00024 domain.

Putative uncharacterized protein KLKB1 (Kallikrein B, plasma (Fletcher factor) 1, isoform CRA_b) contains a PF00024 domain.

Putative uncharacterized protein KLKB1 (Kallikrein B, plasma (Fletcher factor) 1, isoform CRA_b) contains a PF00024 domain.

Putative uncharacterized protein KLKB1 (Kallikrein B, plasma (Fletcher factor) 1, isoform CRA_b) contains a PF00024 domain.

Putative uncharacterized protein KLKB1 (Kallikrein B, plasma (Fletcher factor) 1, isoform CRA_b) contains a PF00089 domain.

Putative uncharacterized protein KLKB1 (Kallikrein B, plasma (Fletcher factor) 1, isoform CRA_b) is proteolytically cut by coagulation factor XIIa (S01.211) cleavage. TSTR-IVGG.

Putative uncharacterized protein KLKB1 (Kallikrein B, plasma (Fletcher factor) 1, isoform CRA_b) is proteolytically cut by coagulation factor XIIa (S01.211) cleavage. TSTR-IVGG.

Putative uncharacterized protein KLKB1 (Kallikrein B, plasma (Fletcher factor) 1, isoform CRA_b) is proteolytically cut by plasma kallikrein (S01.212) cleavage. TFHK-AEYR.

Putative uncharacterized protein KLKB1 (Kallikrein B, plasma (Fletcher factor) 1, isoform CRA_b) is proteolytically cut by coagulation factor XIIa (S01.211) cleavage. TSTR-IVGG.