Beta galactoside alpha 2,6 sialyltransferase 1

UniProt : Q8K1L1, UniProt ID: Q8K1L1_MOUSE,

Beta galactoside alpha 2,6 sialyltransferase 1

Mus musculus

MIHTNLKRKFSCFVLVFLLFAIICVWKKGSDYEALTLQAKVFQMPKSQEKVAVGPAPQAV
FSNSKQDPKEGVQILSYPRVTAKVKPQPSLQVWDKDSTYSKLNPRLLKIWRNYLNMNKYK
VSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKAGPWHK
CAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGTKTTIRLVNSQLVTTEKRF
LKDSLYTEGILILWDPSVYHADIPQWYQKPDYNFFETYKSYRRLHPSQPFYILKPQMPWE
LWDIIQEISPDLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSA
CTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNNRC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Beta galactoside alpha 2,6 sialyltransferase 1 contains a PF00777 domain.

Beta galactoside alpha 2,6 sialyltransferase 1 is proteolytically cut by memapsin-2 (A01.004) cleavage. ALTL-QAKV.