Rattus norvegicus

MIGMNLQLVCLTLLAFSSWSLCSDSEEDVRVLEADLLTNMHASKVSKGSPPSWKMTLLNV
CSLINNLNSAAEEAGEMRDDDLVAKRKLPLVLDDFSLEALLTVFQLQKICRSRAFQHWEI
IQEDILDHGNEKTEKEEVIKRKIPYILKRQLYENKPRRPYILKRASYYY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. VIKR-KIPY.

is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. VIKR-KIPY.

is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. ILKR-QLYE.

is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. ILKR-QLYE.

is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. ILKR-ASYY.

is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. ILKR-ASYY.