PMAP: SubstrateDB : cDNA, FLJ93066, Homo sapiens selectin L (lymphocyte adhesion molecule 1) (SELL),mRNA

cDNA, FLJ93066, Homo sapiens selectin L (lymphocyte adhesion molecule 1) (SELL),mRNA

UniProt : B2R6Q8, P14151, UniProt ID: B2R6Q8_HUMAN, LYAM1_HUMAN,

cDNA, FLJ93066, Homo sapiens selectin L (lymphocyte adhesion molecule 1) (SELL),mRNA

Homo sapiens

MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDN
YTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPN
NKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTC
NCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETT
CGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKK
TICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKK
GKKSKRSMNDPY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

cDNA, FLJ93066, Homo sapiens selectin L (lymphocyte adhesion molecule 1) (SELL),mRNA contains a PF00059 domain.

cDNA, FLJ93066, Homo sapiens selectin L (lymphocyte adhesion molecule 1) (SELL),mRNA contains a PF00084 domain.

cDNA, FLJ93066, Homo sapiens selectin L (lymphocyte adhesion molecule 1) (SELL),mRNA contains a PF00008 domain.

cDNA, FLJ93066, Homo sapiens selectin L (lymphocyte adhesion molecule 1) (SELL),mRNA is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage..

cDNA, FLJ93066, Homo sapiens selectin L (lymphocyte adhesion molecule 1) (SELL),mRNA is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage..

cDNA, FLJ93066, Homo sapiens selectin L (lymphocyte adhesion molecule 1) (SELL),mRNA is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. KLDK-SFSM.