Coagulation factor XI

UniProt : P03951, UniProt ID: FA11_HUMAN,

Coagulation factor XI

Homo sapiens

MIFLYQVVHFILFTSVSGECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFT
FTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDM
KGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITK
LDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFT
FFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTD
FLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKIL
HGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSI
IGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYD
IALLKLETTVNYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLV
TNEECQKRYRGHKITHKMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCA
QRERPGVYTNVVEYVDWILEKTQAV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Coagulation factor XI contains a PF00024 domain.

Coagulation factor XI contains a PF00089 domain.

Coagulation factor XI contains a PF00024 domain.

Coagulation factor XI contains a PF00024 domain.

Coagulation factor XI contains a PF00024 domain.

Coagulation factor XI is proteolytically cut by thrombin (S01.217) cleavage. IKPR-IVGG.

Coagulation factor XI is proteolytically cut by coagulation factor XIa (S01.213) cleavage. IKPR-IVGG.

Coagulation factor XI is proteolytically cut by coagulation factor XIIa (S01.211) cleavage. IKPR-IVGG.

Coagulation factor XI is proteolytically cut by thrombin (S01.217) cleavage..

Coagulation factor XI is proteolytically cut by coagulation factor Xa (S01.216) cleavage..

Coagulation factor XI is proteolytically cut by coagulation factor XIIa (S01.211) cleavage..

Coagulation factor XI is proteolytically cut by thrombin (S01.217) cleavage. IKPR-IVGG.

Coagulation factor XI is proteolytically cut by coagulation factor XIa (S01.213) cleavage. IKPR-IVGG.

Coagulation factor XI is proteolytically cut by coagulation factor XIIa (S01.211) cleavage. IKPR-IVGG.

Coagulation factor XI is proteolytically cut by thrombin (S01.217) cleavage..

Coagulation factor XI is proteolytically cut by coagulation factor Xa (S01.216) cleavage..

Coagulation factor XI is proteolytically cut by coagulation factor XIIa (S01.211) cleavage..

Coagulation factor XI is proteolytically cut by trypsin 1 (S01.151) cleavage. IKPR-IVGG.