Myelin associated glycoprotein

UniProt : Q567S4, UniProt ID: Q567S4_HUMAN,

Myelin associated glycoprotein

Homo sapiens

MIFLTALPLFWIMISASRGGHWGAWMPSSISAFEGTCVSIPCRFDFPDELRPAVVHGVWY
FNSPYPKNYPPVVFKSRTQVVHESFQGRSRLLGDLGLRNCTLLLSNVSPELGGKYYFRGD
LGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGL
GEPAVLGRLREDEGTWVQVSLLHFVPTREANGHRLGCQASFPNTTLQFEGYASMDVKYPP
VIVEMNSSVEAIEGSHVSLLCGADSNPPPLLTWMRDGTVLREAVAESLLLELEEVTPAED
GVYACLAENAYGQDNRTVGLSVMYAPWKPTVNGTMVAVEGETVSILCSTQSNPDPILTIF
KEKQILSTVIYESELQLELPAVSPEDDGEYWCVAENQYGQRATAFNLSVEFAPVLLLESH
CAAARDTVQCLCVVKSNPEPSVAFELPSRNVTVNESEREFVYSERSGLVLTSILTLRGQA
QAPPRVICTARNLYGAKSLELPFQGAHRLMWAKIGPVGAVVAFAILIAIVCYITQTRRKK
NVTESPSFSAGDNPPVLFSSDFRISGAPEKYESKEVSTLESH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Myelin associated glycoprotein contains a PF00047 domain.

Myelin associated glycoprotein contains a PF07679 domain.

Myelin associated glycoprotein contains a PF07686 domain.

Myelin associated glycoprotein contains a PF08205 domain.

Myelin associated glycoprotein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. GYAS-MDVK.

Myelin associated glycoprotein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. GAHR-LMWA.