Uncharacterized serine-rich protein P23A10.11c

UniProt : Q9P7X4, UniProt ID: YH6B_SCHPO,

Uncharacterized serine-rich protein P23A10.11c

Schizosaccharomyces pombe

MIAKSFIASFLFLCFAFSGVKADGCSEENGYYYCNQASEVEFTNVGYSSTYNEITNMDTS
SCSCSSTPKSYGGNLAPFDEEFSFHFRGPIELKRFAVYYPDTSNALSSLRKRSNNQHMKR
HPHHKRDDVIDSTLTVYETVMYTTAVYGDSATTPAASEAQASSDILSSLASLSSASTDNL
AASVTPTTVAASVASSVDTDSASATISSVVDSATSSVSTVIPSSIISAAPPDSASESTPA
STSYASSTTSATSTSTTSGSSGSSDWGRSSFYEADSGTSDNIVFLNNMGGSAGSGVWSSC
FGNSLSFAASNGVDGASSSQVLENILVASDKEFSIWTATECNNDCGYYLPGIPAYHGFSG
AKLVLMEFIMPHDSSSSYNQDMPAIWSLNAQIPRTLQYGNADCSCWTTGCGEFDIFEVLS
TGNEKMIPTLHGSQGSSNGNGGGAGSSDYFARPTSSSMIGAVIYDTSSSGIYIIDVTDQN
VSFDSTYSASDVDAWLQSGATIVQLSS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Uncharacterized serine-rich protein P23A10.11c is proteolytically cut by kexin (S08.070) cleavage. LRKR-SNNQ.

Uncharacterized serine-rich protein P23A10.11c is proteolytically cut by kexin (S08.070) cleavage. HHKR-DDVI.