CG3619-PB, isoform B

UniProt : A4V346, P10041, UniProt ID: A4V346_DROME, DL_DROME,

CG3619-PB, isoform B

Drosophila melanogaster

MHWIKCLLTAFICFTVIVQVHSSGSFELRLKYFSNDHGRDNEGRCCSGESDGATGKCLGS
CKTRFRVCLKHYQATIDTTSQCTYGDVITPILGENSVNLTDAQRFQNKGFTNPIQFPFSF
SWPGTFSLIVEAWHDTNNSGNARTNKLLIQRLLVQQVLEVSSEWKTNKSESQYTSLEYDF
RVTCDLNYYGSGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPKCAKGCEHGHC
DKPNQCVCQLGWKGALCNECVLEPNCIHGTCNKPWTCICNEGWGGLYCNQDLNYCTNHRP
CKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKC
HCANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLD
NCSPNPCINGGSCQPSGKCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCV
PGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHN
GGTCMNRVNSFECVCANGFRGKQCDEESYDSVTFDAHQYGATTQARADGLTNAQVVLIAV
FSVAMPLVAVIAACVVFCMKRKRKRAQEKDDAEARKQNEQNAVATMHHNGSGVGVALASA
SLGGKTGSNSGLTFDGGNPNIIKNTWDKSVNNICASAAAAAAAAAAADECLMYGGYVASV
ADNNNANSDFCVAPLQRAKSQKQLNTDPTLMHRGSPAGSSAKGASGGGPGAAEGKRISVL
GEGSYCSQRWPSLAAAGVAGACSSQLMAAASVAGSGAGTAQQQRSVVCGTPHM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CG3619-PB, isoform B contains a PF07657 domain.

CG3619-PB, isoform B contains a PF01414 domain.

CG3619-PB, isoform B contains a PF00008 domain.

CG3619-PB, isoform B contains a PF00008 domain.

CG3619-PB, isoform B contains a PF00008 domain.

CG3619-PB, isoform B contains a PF00008 domain.

CG3619-PB, isoform B contains a PF00008 domain.

CG3619-PB, isoform B contains a PF00008 domain.

CG3619-PB, isoform B contains a PF00008 domain.

CG3619-PB, isoform B contains a PF00008 domain.

CG3619-PB, isoform B is proteolytically cut by Kuzbanian peptidase (M12.211) cleavage. HQYG-ATTQ.

CG3619-PB, isoform B is proteolytically cut by Kuzbanian peptidase (M12.211) cleavage. GLTN-AQVV.