FI04747p

UniProt : A4V0W1, Q01083, UniProt ID: A4V0W1_DROME, SPITZ_DROME,

FI04747p

Drosophila melanogaster

MHSTMSVQHGLVALVLIGCLAHPWHVEACSSRTVPKPRSSISSSMSGTALPPTQAPVTSS
TTMRTTTTTTPRPNITFPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQR
CEYKEIDNTYLPKRPRPMLEKASIASGAMCALVFMLFVCLAFYLRFEQRAAKKAYELEQE
LQQEYDDDDGQCECCRNRCCPDGQEPVILERKLPYHMRLEHALMSFAIRRSNKL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

FI04747p contains a PF00008 domain.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-2 (MER015452) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-2 (MER015452) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-2 (MER015452) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-2 (MER015452) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-2 (MER015452) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-2 (MER015452) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-2 (MER015452) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by Rhomboid-2 (S54.010) cleavage..

FI04747p is proteolytically cut by Rhomboid-3 (S54.011) cleavage..

FI04747p is proteolytically cut by Rhomboid-4 (S54.012) cleavage..

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. ASIA-SGAM.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by GlpG peptidase (S54.016) cleavage. IASG-AMCA.

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by rhomboid peptidase PfROM1 (S54.018) cleavage..

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.

FI04747p is proteolytically cut by Rhomboid-1 (S54.001) cleavage. MLEK-ASIA.