Chymotrypsinogen A

UniProt : P00766, UniProt ID: CTRA_BOVIN,

Chymotrypsinogen A

Bos taurus

CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Chymotrypsinogen A contains a PF00089 domain.

Chymotrypsinogen A is proteolytically cut by trypsin 1 (S01.151) cleavage. GLSR-IVNG.

Chymotrypsinogen A is proteolytically cut by chymotrypsin A (S01.001) cleavage. LTRY-TNAN.

Chymotrypsinogen A is proteolytically cut by chymotrypsin A (S01.001) cleavage. LSGL-SRIV.

Chymotrypsinogen A is proteolytically cut by chymotrypsin A (S01.001) cleavage. RYTN-ANTP.