Chymotrypsinogen A
|
UniProt : P00766, UniProt ID: CTRA_BOVIN, Chymotrypsinogen A Bos taurus CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ TLAAN The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Chymotrypsinogen A contains a PF00089 domain.
Chymotrypsinogen A is proteolytically cut by trypsin 1 (S01.151) cleavage. GLSR-IVNG.
Chymotrypsinogen A is proteolytically cut by chymotrypsin A (S01.001) cleavage. LTRY-TNAN.
Chymotrypsinogen A is proteolytically cut by chymotrypsin A (S01.001) cleavage. LSGL-SRIV.
Chymotrypsinogen A is proteolytically cut by chymotrypsin A (S01.001) cleavage. RYTN-ANTP.