Complement C3 (Fragment)

UniProt : P98093, UniProt ID: CO3_ONCMY,

Complement C3 (Fragment)

Oncorhynchus mykiss

AALQVLSAPNLLRVGSNENIFVESQDHVGGPLNVKIMVKNHPTQSKELASKSVVLDQANN
FQAMTQLVIQRGPLVDDPKQKQYVVLQAQFPDRLLEKVVLVSFQSGYIFIQTDKTIYTPA
STVHYRVFSMTPGLEPLTREIFEDQEVAKNKEIAVSVEIMTPENITIFREIVNPDKGVKS
GQFKLPDIVSFGTWHVVTRFQSTPQKTFSSEFEVKEYVLPSFEVSLTPAKAFFYVDDNDL
TVDITARYLYGKEVTGTGYVVFGVITTESEKKSFPASLQRVEIKDGKGVACLKKEHITQT
FPKIHDLVKQSIFVSVSVLTEGGGEMVEAEKRGIQIVTSPYSILFKRTPKYFKPGMPFDV
SVYITNPDNSPAIGVEVEVTPDHAKGVTRANGFAKIPLNTVASATELVITVKTKDPGDPR
QQTGGGTMKALPYRTSTKNFLHVGVDSNELKIGDPIKIDLNLGPTTIPNHDLTYMFLSRG
QLVKVGRFKRQGNALVTLSVPVSKELLPSFRIVAYYHVGAADLVADSVWVDIKVSCMGSL
KVTSTRPKASYEPRRAFSLTITGDPGAKVGLVAVDKGVYVLNSKHRLTQTKIWDTIEKHD
TGCTAGGGADNMGVFYDAGLVFETNTAKGTGIRTDPSCPVSSRRRRAVTISDVITSMASK
YHGLAKECCVDGMRDNTMGYTCDRRAQYISDGDVCVQAFLVCCTEMASKKIESKQDALLL
SRSEEDDDDDAYMRSEDIVSRSQFPESWMWEDTNLPECPAQNKHCESTSVIRNNFLKDSI
TTWQITAISLSKTHGICVADPFEMIVLKEFFIDLKLPYSAVRNEQLEVKAILHNYSEDPI
IVRVELMENGEVCSSASKKGKYRQEVNMDPMSTRVVPYVIIPMKLGLHSIEVKASVKNSG
SNDGVKRDLRVVAEGVLVKKETNVLLNPVKHGGEQTSHIPSGVPRNQVPNSDADTLISVT
AGEQTSVLVEQAISGDSLGSLIVQPVGCGEQNMIYMTLPVIATHYLDNTKKWEDIGLDKR
NTAIKYINIGYQRQLAYRKEDGSYAAWVSRQSSTWLTAYVVKVFAMSSTLISVQENVLCT
AVKWLILNTQQPDGIFNEFAPVIHAEMTGNVRGSDNDASMTAFVLIAMQEASSVCEQSVN
SLPGSMAKAVAYLEKRLPHLTNPYAVAMTSYALANAGKLNKETLLKFASPQLDHWPVPGG
YQYTLEATSYALLALVKVKAFEEAGPIVRWLNKQKKVGGGYGSTQSTIMVFQAVAEYWSH
VKDLKDFDLNINLEVAGRASVTKWSINNKNQFHTRTDKVNSIDKDLTVKASGNGEATLSV
VTLYYALPEEKDSDCESFDLSVTLTKMDKTSHEDAKESFMLTIEVLYKNSERDATMSILD
IGLLTGFIVDTDDLNQLSKGRERYIEKFEMDKVLSERGSLILYLDKVSHKLEDRISFKIH
RVQEVGVLQPAAVSVYEYYNQKRCVKFYHPQREGGTLSRLCLGDVCTCAEESCSMQKKGE
PDVQRIDKACGAGLDYVYKATVVDSKLTTHTDTYTVKIDLVIKPGTDEGVEGKNRDFMGL
AYCREALGLMQGKTYMIMGKSEDLHRVEDKGLLQYKYVLGEQTWIEYWPSQQECTSRDYR
EVCLGIDEFINQITTFGCPV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Complement C3 (Fragment) contains a PF00207 domain.

Complement C3 (Fragment) contains a PF01759 domain.

Complement C3 (Fragment) contains a PF01821 domain.

Complement C3 (Fragment) contains a PF01835 domain.

Complement C3 (Fragment) contains a PF07677 domain.

Complement C3 (Fragment) contains a PF07678 domain.

Complement C3 (Fragment) contains a PF07703 domain.

Complement C3 (Fragment) is proteolytically cut by complement factor I (S01.199) cleavage. FHTR-TDKV.

Complement C3 (Fragment) is proteolytically cut by complement component 2 (S01.194) cleavage. LLSR-SEED.